Shewanella psychrophila: Sps_03331 Help Entry Sps_03331         CDS       T05063                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spsw  Shewanella psychrophila Pathway spsw00998   Biosynthesis of various antibiotics spsw01100   Metabolic pathways spsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sps_03331    00074 Mycolic acid biosynthesis     Sps_03331   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sps_03331 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AQS38467 UniProt:  A0A1S6HSD8 LinkDB All DBs Position 3830744..3830992 Genome browser AA seq 82 aa AA seqDB search MQSREQILQVLTRILVDEFEIDEADISPTASLYEELDLDSIDAVDLVIKLQQMTGKKIKP EEFKAVRTVDDVVSAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgtgaacaaattctgcaagtcctaactcgcatcttagtcgatgaattcgag atagatgaagcggatatctcaccaacagcttccctgtatgaagagcttgatctggacagt attgatgctgtcgacctagtcatcaaactgcaacaaatgacaggcaaaaaaatcaagcct gaagagtttaaagccgtgcgtaccgtggacgatgtagtttctgccatcgaagggctcgtc aaagattaa

DBGET integrated database retrieval system