Shewanella psychrophila: Sps_04541 Help Entry Sps_04541         CDS       T05063                                  Name (GenBank) PPIC-type PPIASE family protein   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism spsw  Shewanella psychrophila Brite KEGG Orthology (KO) [BR:spsw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:spsw03110]     Sps_04541 Enzymes [BR:spsw01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      Sps_04541 Chaperones and folding catalysts [BR:spsw03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     Sps_04541 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Motif Other DBs NCBI-ProteinID:  AQS39626 UniProt:  A0A1S6HVM4 LinkDB All DBs Position 5158050..5158328 Genome browser AA seq 92 aa AA seqDB search MAKTAAALHILVKHKEQAEDIIKQLKKGTKFDVLAKKHSTCPSGKKGGSLGEFKKGQMVP QFDKVCFTGELITPHLVKTKFGWHVIKILYRT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaactgctgctgcgctgcacatattagttaaacataaagagcaagctgaagac atcatcaagcaactaaaaaaaggcactaaattcgatgtgttagccaagaaacattcgact tgcccatcgggtaagaaaggcggcagcttaggtgaattcaagaaaggtcagatggtgcct caatttgataaggtctgtttcacaggtgagcttattactccgcatctggtcaaaacaaaa ttcggctggcatgtgataaaaatactttatcggacttaa

DBGET integrated database retrieval system