KEGG   Sphingobium sp. TA15: Sj15T_08590
Entry
Sj15T_08590       CDS       T11324                                 
Symbol
rnc
Name
(GenBank) ribonuclease 3
  KO
K03685  ribonuclease III [EC:3.1.26.3]
Organism
spta  Sphingobium sp. TA15
Brite
KEGG Orthology (KO) [BR:spta00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    Sj15T_08590 (rnc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spta03019]
    Sj15T_08590 (rnc)
   03009 Ribosome biogenesis [BR:spta03009]
    Sj15T_08590 (rnc)
   03036 Chromosome and associated proteins [BR:spta03036]
    Sj15T_08590 (rnc)
Enzymes [BR:spta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.3  ribonuclease III
     Sj15T_08590 (rnc)
Messenger RNA biogenesis [BR:spta03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Sj15T_08590 (rnc)
Ribosome biogenesis [BR:spta03009]
 Eukaryotic type
  90S particles
   RNase
    Sj15T_08590 (rnc)
 Prokaryotic type
  rRNA processing factors
   Sj15T_08590 (rnc)
Chromosome and associated proteins [BR:spta03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Microprocessor complex
     Sj15T_08590 (rnc)
SSDB
Other DBs
NCBI-ProteinID: BDD65838
LinkDB
Position
1:880596..881267
AA seq 223 aa
MTKADTEGWLKALIGHAPKDRTAFHQALTHGSAHAVNYERLEFLGDRILGLLIAEWVYDR
FSGEPEGKLSRRFNALVSGETCAEVARGAGVPAHLILGKQARDDGAADSDNVLGDVMEAL
IGALYLEGGLEEARTLVRRLWADRVDTQASAPKHPKSALQEWAAANKRKPPEYAMTDRSG
PHHALKFTVTVSIKGAGEASATGGSKQEAETAAAKALLDKLTA
NT seq 672 nt   +upstreamnt  +downstreamnt
ttgacgaaagcggacaccgaaggctggctgaaggccctgatcggccacgcgccgaaggac
cggacggccttccatcaagcgctgacccatggcagcgcccatgcggtgaactatgaacgg
ctggagttcctgggcgaccgcatcctcggcctgctgatcgccgaatgggtctatgaccgc
ttttcgggcgaaccggaaggcaagctctcccgccgcttcaacgcgctggtgtcgggcgag
acctgcgccgaagtcgcccgcggcgccggggttccggcgcatctcatcctcgggaagcag
gcccgcgacgatggcgccgccgacagcgacaatgtgctgggcgacgtgatggaggcgctg
atcggcgcgctctatctggagggcgggctggaggaggcccgcaccctggtccgccgcctc
tgggccgaccgcgtcgacacccaggccagcgcgcccaagcatcccaaatccgccctccag
gaatgggccgccgccaacaagcgcaagcccccggaatatgcgatgaccgaccgctccgga
ccccaccacgccctgaaattcacggtaacggtcagcatcaagggcgcaggcgaagcaagc
gcgacgggcggctccaaacaggaagccgaaaccgcagcggcaaaggcattgctggacaaa
ctgaccgcgtaa

DBGET integrated database retrieval system