Sinomonas puerhi: AB5L97_07755 Help Entry AB5L97_07755      CDS       T10941                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spue  Sinomonas puerhi Pathway spue00998   Biosynthesis of various antibiotics spue01100   Metabolic pathways spue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spue00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB5L97_07755    00074 Mycolic acid biosynthesis     AB5L97_07755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB5L97_07755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  XDP46877 UniProt:  A0AB39L8U1 LinkDB All DBs Position complement(1702807..1703061) Genome browser AA seq 84 aa AA seqDB search MEITIDGLKDLMISRLGLDMEPGDIQPEDSLQNDLGLDSVDLLEVAIGIERTYRVKITQN DTAAFESLQSLFDFCSEQSLAGVK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggaaatcacgatcgacggcctcaaggacctcatgatctcccgactcggcctggatatg gaaccgggcgatatccagcccgaggattcgctccagaatgaccttggcctcgattcggtt gaccttctcgaggtagccatcggcatcgagcggacgtaccgggtcaagatcacccagaat gacaccgccgcgttcgagtccctgcagtcgctcttcgacttctgcagcgagcagtctctc gccggcgtcaagtga

DBGET integrated database retrieval system