Streptomyces fodineus: BFF78_06335 Help Entry BFF78_06335       CDS       T05140                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism spun  Streptomyces fodineus Pathway spun00362   Benzoate degradation spun00621   Dioxin degradation spun00622   Xylene degradation spun01100   Metabolic pathways spun01120   Microbial metabolism in diverse environments spun01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:spun00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BFF78_06335    00622 Xylene degradation     BFF78_06335    00621 Dioxin degradation     BFF78_06335 Enzymes [BR:spun01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BFF78_06335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 Motif Other DBs NCBI-ProteinID:  AOR30716 UniProt:  A0A1D7Y5A0 LinkDB All DBs Position 1509631..1509846 Genome browser AA seq 71 aa AA seqDB search MPYANFKVPAGTLTDEQKAQIITRTTDLYTEIYGERARATTLVLVEEVPDGGWGIGGHVL TAAEIQQAPAG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccgtacgcgaacttcaaggtccccgcaggcaccctcaccgacgagcagaaggcgcag atcatcacccgcaccaccgacctgtacaccgagatctacggcgaacgtgcccgcgccacc accctggtgctcgtcgaggaggtgcccgacggcggctggggcatcggcggccacgtcctg accgccgccgagatccagcaggcgcccgcaggctga

DBGET integrated database retrieval system