Streptomyces fodineus: BFF78_15035 Help Entry BFF78_15035       CDS       T05140                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism spun  Streptomyces fodineus Brite KEGG Orthology (KO) [BR:spun00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     BFF78_15035 Enzymes [BR:spun01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      BFF78_15035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like GST_N_2 Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  AOR32204 UniProt:  A0A1D7Y9P6 LinkDB All DBs Position 3668610..3668852 Genome browser AA seq 80 aa AA seqDB search MQGTVTMYSTTWCGYCRRLKSQLEREGIAYTEINIEQDPESAIFVEKANGGNQTVPTVLF ADGTTLTNPSLAQVKQKLAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcagggcactgtgacgatgtacagcacgacttggtgcggctactgccggcggctgaag agccagctggaacgggagggcatcgcctacaccgagatcaacatcgagcaggaccccgag tccgccatttttgtcgagaaggcgaatggcggaaaccagacggtcccgaccgtgctcttc gcggacggcaccacgctgacgaacccgtcgctggcccaggtgaagcagaagctcgccgcg tga

DBGET integrated database retrieval system