Streptomyces fodineus: BFF78_29105 Help Entry BFF78_29105       CDS       T05140                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spun  Streptomyces fodineus Pathway spun00998   Biosynthesis of various antibiotics spun01100   Metabolic pathways spun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BFF78_29105    00074 Mycolic acid biosynthesis     BFF78_29105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BFF78_29105 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AOR34566 UniProt:  A0A1D7YGA9 LinkDB All DBs Position complement(6797408..6797656) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagaccgtcggtgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system