Streptomyces fodineus: BFF78_29720 Help Entry BFF78_29720       CDS       T05140                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism spun  Streptomyces fodineus Pathway spun00362   Benzoate degradation spun00621   Dioxin degradation spun00622   Xylene degradation spun01100   Metabolic pathways spun01120   Microbial metabolism in diverse environments spun01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:spun00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     BFF78_29720    00622 Xylene degradation     BFF78_29720    00621 Dioxin degradation     BFF78_29720 Enzymes [BR:spun01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      BFF78_29720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 DUF2917 Motif Other DBs NCBI-ProteinID:  AOR37404 UniProt:  A0A1D7YPF1 LinkDB All DBs Position 6922996..6923193 Genome browser AA seq 65 aa AA seqDB search MPLIHVQQTPGKTAEQKAELVRELTDAYVKATGSKPESVWVTVQEIGTDSWSIAGETLAA RAAKR NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcctctcatccatgtgcagcagacccccggcaagaccgccgagcagaaggccgagttg gtccgtgagctgaccgacgcgtacgtcaaggccaccggcagcaagccggagagcgtgtgg gtgaccgtgcaggagatcggcaccgacagctggtccatcgccggtgagacgctggccgcc cgcgccgccaagcgctga

DBGET integrated database retrieval system