Sphingopyxis sp. USTB-05: KEC45_01150 Help Entry KEC45_01150       CDS       T10625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spus  Sphingopyxis sp. USTB-05 Pathway spus01100   Metabolic pathways spus01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spus00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KEC45_01150    00074 Mycolic acid biosynthesis     KEC45_01150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KEC45_01150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF2827 Motif Other DBs NCBI-ProteinID:  USI77559 LinkDB All DBs Position complement(237753..237989) Genome browser AA seq 78 aa AA seqDB search MSTALTDQIFGLIQPFNKKGVELTDATTFAGDLEWDSLTVMDFVAEVEDTFDIIISMNMQ AEIETVGQLVAAVEKLKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgccctcaccgaccagattttcggcctgatccaacccttcaacaaaaagggc gtcgaactgaccgacgccacgacctttgccggcgacctcgaatgggacagcctgacggtc atggattttgttgccgaggtcgaggacacattcgacatcatcatcagcatgaacatgcag gccgaaatcgaaaccgtcggccagttggttgccgccgtcgagaagctgaagggctga

Sphingopyxis sp. USTB-05: KEC45_04590 Help Entry KEC45_04590       CDS       T10625                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spus  Sphingopyxis sp. USTB-05 Pathway spus01100   Metabolic pathways spus01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spus00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KEC45_04590    00074 Mycolic acid biosynthesis     KEC45_04590   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KEC45_04590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  USI78189 LinkDB All DBs Position 1041743..1041979 Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaaaaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaagaagcaagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactggtgatggcgttcgaagaagaatttggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcaaggacgcgatcgactatatcgaagcgaacaagggctga

DBGET integrated database retrieval system