Sphingobium sp. WTD-1: N6H05_22935 Help Entry N6H05_22935       CDS       T10837                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spwt  Sphingobium sp. WTD-1 Pathway spwt00190   Oxidative phosphorylation spwt01100   Metabolic pathways Module spwt_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spwt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     N6H05_22935  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spwt00194]     N6H05_22935 Photosynthesis proteins [BR:spwt00194]  Photosystem and electron transport system   F-type ATPase [OT]    N6H05_22935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  WIA55835 LinkDB All DBs Position 4615375..4615629 Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSEEVYQVVVPGTDGDFGVLEGHAPFMSTVRDGAIQIFASAGAAPE IIPVEGGFAEVNEKGLTVLAEKAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtgacccctgaaaagctcgtccgctcggaagaggtctat caggtcgtcgttcccggcaccgatggcgactttggcgtgctggagggccatgcgcccttc atgtcgaccgtgcgcgatggcgcgatccagatcttcgcatcggctggcgccgcaccagaa atcatcccggtcgagggcggctttgccgaggtcaatgaaaagggcctgacggttctcgcc gaaaaggcgggctaa

DBGET integrated database retrieval system