Sphingobium sp. YG1: YGS_C1P0460 Help Entry YGS_C1P0460       CDS       T05858                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spyg  Sphingobium sp. YG1 Pathway spyg01100   Metabolic pathways spyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spyg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YGS_C1P0460    00074 Mycolic acid biosynthesis     YGS_C1P0460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YGS_C1P0460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  BBC99204 LinkDB All DBs Position 1:463792..464025 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgttgaagcc gagaaggtgaccgaggacgccagcttcatcgacgatctgggcgcggacagcctggacatc gtcgaactggtgatggcgttcgaagaagaattcggcgtcgaaatccccgacgacgctgcc gagaagatcgccaccgtcaaggacgcgatcgattatatcgacagcaagcagtaa

DBGET integrated database retrieval system