Sphingobium sp. YG1: YGS_C1P0474 Help Entry YGS_C1P0474       CDS       T05858                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism spyg  Sphingobium sp. YG1 Pathway spyg01100   Metabolic pathways spyg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spyg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     YGS_C1P0474    00074 Mycolic acid biosynthesis     YGS_C1P0474   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     YGS_C1P0474 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBC99218 UniProt:  A0A2Z6AB77 LinkDB All DBs Position 1:complement(477882..478127) Genome browser AA seq 81 aa AA seqDB search MDSLMRALLRDVLGLSQDRVDAFDADTPLFGALPELDSMAVAGLLTEMEDRFDILIEDED IDGDTFETFGSLVAFAQAKVG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggacagcctgatgcgggcgttgctgcgcgacgtgctcggcctgtcgcaggacagggtc gatgcgttcgacgcggacaccccgctgttcggcgccctccccgaactggattccatggcg gtcgccggattgctgaccgagatggaggatcgtttcgacatcctgatcgaggatgaggat atagacggcgacacgttcgagacgttcggatcgctggtcgccttcgcccaggccaaggtc ggctga

DBGET integrated database retrieval system