Stakelama tenebrarum: G5C33_11665 Help Entry G5C33_11665       CDS       T06464                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism spzr  Stakelama tenebrarum Pathway spzr01100   Metabolic pathways spzr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spzr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5C33_11665    00074 Mycolic acid biosynthesis     G5C33_11665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5C33_11665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QIG81917 UniProt:  A0A6G6YAS1 LinkDB All DBs Position complement(2371528..2371764) Genome browser AA seq 78 aa AA seqDB search MMSTADRVTKIVSEHLGVQESDVTPEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDEHQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atcatgagcaccgcggatcgtgtgaccaagatcgtcagcgagcatctcggcgtccaggaa tcggacgtcacgccggaagccagcttcatcgacgatctgggcgccgacagcctcgacatc gttgaactcgtcatggctttcgaagaagaattcggcgtcgagatccccgatgacgctgca gagaagatcacgaccgtcaaggacgcgatcacctatatcgacgaacatcagggctga

DBGET integrated database retrieval system