Sphingomonas qomolangmaensis: NMP03_04005 Help Entry NMP03_04005       CDS       T08594                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sqo  Sphingomonas qomolangmaensis Pathway sqo00998   Biosynthesis of various antibiotics sqo01100   Metabolic pathways sqo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sqo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NMP03_04005    00074 Mycolic acid biosynthesis     NMP03_04005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NMP03_04005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UUL83402 UniProt:  A0ABY5LC23 LinkDB All DBs Position 834476..834712 Genome browser AA seq 78 aa AA seqDB search MSDTADRVKKIVVENLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVRDAITYIDEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaccgccgatcgcgtgaagaagattgtcgtcgagaacctgggcgtcgaggcc gagaaggtcaccgaggacgcgagcttcatcgacgacctgggcgcagacagcctcgacatc gtcgagctggtgatggcgttcgaagaggaattcggcgtcgagatccccgacgatgccgcc gagaagatcaccaccgtgcgcgacgcgatcacctatatcgacgagcacaagggctga

DBGET integrated database retrieval system