KEGG   Sphingomonas qomolangmaensis: NMP03_10350
Entry
NMP03_10350       CDS       T08594                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sqo  Sphingomonas qomolangmaensis
Pathway
sqo00260  Glycine, serine and threonine metabolism
sqo00750  Vitamin B6 metabolism
sqo01100  Metabolic pathways
sqo01110  Biosynthesis of secondary metabolites
sqo01120  Microbial metabolism in diverse environments
sqo01230  Biosynthesis of amino acids
Module
sqo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sqo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMP03_10350 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMP03_10350 (thrC)
Enzymes [BR:sqo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMP03_10350 (thrC)
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: UUL81601
UniProt: A0ABY5LA67
LinkDB
Position
2200288..2201682
AA seq 464 aa
MRYISTRGNAPVLDFEGVTLAGLAADGGLYVPETWPSFSRDEIAAMQGLSYVETAVRVMA
PFVAGSLTEDELRDLCTTAYSRFAHAAVTPLVQLDQRHWLLELFHGPTLAFKDVALQLVG
LLFERFLAGREGQLTVIGATSGDTGSAAIDALAGRVGVDIFMLHPEGRVSDVQRRQMTTV
IAPNIHNIAIRGDFDTAQALVKAMFRDPAFSTRYALSAVNSINWARLMAQVVYYFYAAVR
LGGPERPVAFSVPTGNFGDVFAGYVAARMGLPIERLIVATNVNDILHRALSTGDYSSGTV
TPTATPSMDIQVSSNFERLLFELGDRSGAALAAQMAGFESSRAMMLTNRQREGAAGLFTS
ASIDADGMGQALRWAHERSGQVIDPHTAIGLAAARADVGNTPMVTLATAHPAKFRDAVER
STGVRPGLPARMGDLFSREERYDTIDATFDAVTDYIAQRATPRG
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcgctacatcagcaccagggggaacgcgcccgtcctcgatttcgagggcgtgacgctg
gcgggacttgcagccgatggcgggctgtacgtgcccgagacatggccgagcttcagccgc
gacgagatcgcagcgatgcaggggctgtcctatgtcgagaccgcggtgcgcgtcatggcg
cccttcgtcgcggggagtctgaccgaagacgagctgcgcgacctgtgcaccaccgcctat
agccgcttcgcgcacgccgcggtcaccccgctggtccagctcgaccagcgccactggctg
ctcgagctgttccacggcccgacgctcgcgttcaaggacgtcgcgctccagctcgtcggc
ctgctgttcgagcgcttcctggcggggcgcgagggccaactcacggtgatcggcgcgact
tcgggcgataccggctcggcggcgatcgatgcgctggcgggacgcgtcggcgtcgacatc
ttcatgctccatcccgagggccgcgtgagcgacgtccagcgccgccagatgaccacggtg
atcgcgcccaacatccacaacatcgcgatccgcggcgatttcgataccgcgcaggcgctg
gtgaaggcgatgttccgcgatcccgccttctcgacccgctatgcgctgtcggcggtcaat
tcgatcaactgggcgcggttgatggcgcaggtggtctattatttctacgccgcggttcgt
ctcggcgggcccgagcgcccggtcgccttctcggtccccaccggcaatttcggcgatgtg
ttcgcaggctatgtcgcggcgcggatggggctgccgatcgagcggctgatcgtcgccacc
aacgtcaacgacatcctccaccgtgctctcagcaccggcgattattcgagcgggacggtc
acccccaccgcgacgccgtcgatggacatccaggtcagctcgaacttcgaacggctgttg
ttcgaactgggcgatcgcagcggcgcggcgctagccgcgcagatggcggggttcgaatcg
agccgcgcgatgatgctcaccaaccgccagcgcgagggcgcggcggggttgttcacctcg
gcatcgatcgacgccgacggcatgggtcaggcgctgcgctgggcgcacgaacgtagcggc
caggtgatcgacccgcacaccgcgatcggcctcgccgccgcgcgcgccgatgtgggcaac
accccgatggtaacgctggcgaccgcgcaccccgccaagttccgcgacgcggtcgaacgc
tcgaccggggtgcggccgggcctgccggcgcggatgggcgatttgttcagccgcgaggag
cgctacgacacgatcgacgcgaccttcgacgcggtgaccgactacatcgcacagcgggcg
acgccgcgtggttga

DBGET integrated database retrieval system