Serratia quinivorans: E4343_12045 Help Entry E4343_12045       CDS       T05941                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism squ  Serratia quinivorans Pathway squ01100   Metabolic pathways squ01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:squ00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E4343_12045    00074 Mycolic acid biosynthesis     E4343_12045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E4343_12045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBX66875 LinkDB All DBs Position complement(2571240..2571491) Genome browser AA seq 83 aa AA seqDB search MDKQEIYLQIQALLVKLFELDADDIKPESRLYEELELDSIDAVDLVVHLQKTTGKKIKPE MFKSVRTVQDVVDAIDELLKSDS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataagcaagaaatttacctgcagattcaggcgttgctggtcaaactgtttgaactt gatgccgatgatatcaagcccgagtcccgcctgtacgaagagctggagctggacagcatt gatgcggtggatctggtggtacacctgcaaaaaacaaccggcaagaagatcaaaccggaa atgttcaagtcggtgcgcaccgtgcaagacgtagttgatgccattgatgagttgcttaag tcagacagttaa

DBGET integrated database retrieval system