Streptomyces qinzhouensis: FQU76_30285 Help Entry FQU76_30285       CDS       T06686                                  Name (GenBank) acyl carrier protein   KO K21183   peptidyl carrier protein Organism sqz  Streptomyces qinzhouensis Brite KEGG Orthology (KO) [BR:sqz00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01059 Biosynthesis of enediyne antibiotics     FQU76_30285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDY80085 UniProt:  A0A5B8JEA3 LinkDB All DBs Position 7053263..7053493 Genome browser AA seq 76 aa AA seqDB search MIADKVRTIWCRELQCDDIAVDDNFFALGGQSVIMAKIQGAFIEELGVEVPVDQMFLNPT VASISAYIESLDPAAP NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgatcgccgacaaggtgcgcaccatctggtgccgggaactccagtgcgacgacatagcg gtcgacgacaacttcttcgccctgggcggccagtccgtgatcatggcgaaaatccagggc gcctttatcgaggagctgggcgtcgaggtcccggtcgaccagatgttcctcaatccgacg gtggcatcgatatccgcttacatcgaatccctggacccggccgcaccgtag

DBGET integrated database retrieval system