Serratia sp. AS13: SerAS13_0814 Help Entry SerAS13_0814      CDS       T02012                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sra  Serratia sp. AS13 Pathway sra01100   Metabolic pathways sra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SerAS13_0814    00074 Mycolic acid biosynthesis     SerAS13_0814   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SerAS13_0814 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEG26626 UniProt:  A0A7U3YZ26 LinkDB All DBs Position 915319..915579 Genome browser AA seq 86 aa AA seqDB search MNLLSTEIKQLIIDTLNLEGMTPEEIDAEAPLFGEGLGLDSIDALELGLALKNRYGVVLS AESEDMRQHFYSVETLVKFVSALRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatttattgagcaccgaaatcaagcaattgatcattgatacgctcaatcttgaaggt atgacgccggaggagattgatgccgaagcaccgctgtttggcgagggactgggcctggat tcgattgatgcgttggaattgggcctggcattaaagaaccgttatggcgtggtgctgtca gctgaaagcgaagacatgcgccaacatttttattccgtggaaacgctggtgaagtttgtt tctgcactgcgtagcaaataa

DBGET integrated database retrieval system