KEGG   Serratia sp. AS13: SerAS13_0915
Entry
SerAS13_0915      CDS       T02012                                 
Name
(GenBank) alpha/beta hydrolase fold protein
Organism
sra  Serratia sp. AS13
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase
Other DBs
NCBI-ProteinID: AEG26727
LinkDB
Position
complement(1020413..1021258)
AA seq 281 aa
MMNDFPTLLDRHIIVGGHRIAAGVHGAGDPLVLVHGTPAHSIIWHNLLPRLTSAGFQVHL
YDLLGFGASERPLSADTSIAAQAELLIGLLDHWQLDTAHVFGHDIGGALSLRAAFSHAER
FRSLTIADICSYDSWPSPTWRGIRDNYRQYAVMDERQHEQTLERQLKMAVFDKSLMEGEL
LQRYLAPIVGVVGQPAFYQQQIAHYNARYTEDFAQRLPELCLPVQILWGENDEWQPVSYA
YRLQAHIPDARLQVIPRAGHFVMEDAPETVAQRLAAFIHSL
NT seq 846 nt   +upstreamnt  +downstreamnt
atgatgaacgacttccctaccctgctcgatcggcacattatcgtcggtggccatcgcatt
gctgccggcgtgcacggtgcaggcgatcctctggtgctggtgcacggtacgcccgcccac
tcgatcatctggcataacctgctgcccaggttgacgtctgcgggctttcaggtccacctc
tacgatttactgggttttggcgcgtcagagcgcccgctgtcagcagacacgtcgattgcc
gcacaggcggagttgctgattggcctgctggatcactggcaactggataccgcccacgtc
tttggtcacgatattggcggcgcgctgtcattacgtgcggcgtttagccatgcggagcgc
tttcgctcgctgaccatcgcagatatttgcagctacgattcctggccttcgcccacctgg
cgcggtattcgcgataactatcgtcagtacgccgtgatggacgagcggcagcatgagcaa
accctggagcggcaactgaaaatggcggtgttcgacaaatcgctgatggagggagaatta
ttgcagcgctatctggcgccgatcgtcggcgtggtcggccaaccggcgttctatcagcag
caaatcgcccattacaacgcccgctatactgaggatttcgcacaacgcctgcccgaactg
tgcctgccggtgcagatcctgtggggcgaaaacgatgaatggcaaccggtcagttacgcc
taccgtttgcaggcccacattcccgatgccaggctgcaggtgatcccccgcgcagggcat
tttgtcatggaagatgcgccggagacggtggcgcaacggttggcggcatttatacattca
ctataa

DBGET integrated database retrieval system