Serratia sp. AS13: SerAS13_0915
Help
Entry
SerAS13_0915 CDS
T02012
Name
(GenBank) alpha/beta hydrolase fold protein
Organism
sra
Serratia sp. AS13
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Abhydrolase_1
Abhydrolase_6
Hydrolase_4
Ndr
Thioesterase
Motif
Other DBs
NCBI-ProteinID:
AEG26727
LinkDB
All DBs
Position
complement(1020413..1021258)
Genome browser
AA seq
281 aa
AA seq
DB search
MMNDFPTLLDRHIIVGGHRIAAGVHGAGDPLVLVHGTPAHSIIWHNLLPRLTSAGFQVHL
YDLLGFGASERPLSADTSIAAQAELLIGLLDHWQLDTAHVFGHDIGGALSLRAAFSHAER
FRSLTIADICSYDSWPSPTWRGIRDNYRQYAVMDERQHEQTLERQLKMAVFDKSLMEGEL
LQRYLAPIVGVVGQPAFYQQQIAHYNARYTEDFAQRLPELCLPVQILWGENDEWQPVSYA
YRLQAHIPDARLQVIPRAGHFVMEDAPETVAQRLAAFIHSL
NT seq
846 nt
NT seq
+upstream
nt +downstream
nt
atgatgaacgacttccctaccctgctcgatcggcacattatcgtcggtggccatcgcatt
gctgccggcgtgcacggtgcaggcgatcctctggtgctggtgcacggtacgcccgcccac
tcgatcatctggcataacctgctgcccaggttgacgtctgcgggctttcaggtccacctc
tacgatttactgggttttggcgcgtcagagcgcccgctgtcagcagacacgtcgattgcc
gcacaggcggagttgctgattggcctgctggatcactggcaactggataccgcccacgtc
tttggtcacgatattggcggcgcgctgtcattacgtgcggcgtttagccatgcggagcgc
tttcgctcgctgaccatcgcagatatttgcagctacgattcctggccttcgcccacctgg
cgcggtattcgcgataactatcgtcagtacgccgtgatggacgagcggcagcatgagcaa
accctggagcggcaactgaaaatggcggtgttcgacaaatcgctgatggagggagaatta
ttgcagcgctatctggcgccgatcgtcggcgtggtcggccaaccggcgttctatcagcag
caaatcgcccattacaacgcccgctatactgaggatttcgcacaacgcctgcccgaactg
tgcctgccggtgcagatcctgtggggcgaaaacgatgaatggcaaccggtcagttacgcc
taccgtttgcaggcccacattcccgatgccaggctgcaggtgatcccccgcgcagggcat
tttgtcatggaagatgcgccggagacggtggcgcaacggttggcggcatttatacattca
ctataa
DBGET
integrated database retrieval system