KEGG   Serratia sp. AS13: SerAS13_1742
Entry
SerAS13_1742      CDS       T02012                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
sra  Serratia sp. AS13
Pathway
sra00333  Prodigiosin biosynthesis
sra01100  Metabolic pathways
sra01110  Biosynthesis of secondary metabolites
Module
sra_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:sra00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SerAS13_1742
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: AEG27530
UniProt: A0A7U4DW26
LinkDB
Position
complement(1889294..1890196)
AA seq 300 aa
MLMSCGLFFEYVSTLLKHAGYPLNWRWEGTHRDDPVGGLISFTPAMPITADINAYSQLAK
AITERRTVRAPYQPTQVNPIQQACLQTLFDGSPVTLHFYQGEPVRHAVAHLTTRYASLDF
SHHQAWQETYQFIRFNERQYTEDGFYLHNLFGPVSNLFKCVFRIAFHPKLTPLATRLQLP
AMMAKGLAKQVGEGPQYLAMSLQDESDEHLFIAGMTLGQLWLTLHSWGWGLHPISVLVQH
ASARHALSDTLALVNPAVFFARFGHLQQSGAATPRRSWQSILTVSHQHSAAETKADVSKF
NT seq 903 nt   +upstreamnt  +downstreamnt
atgctgatgagctgtggccttttcttcgagtatgtcagcactctgctaaaacacgccggt
tacccgcttaactggcggtgggaaggtacgcatcgggatgatcctgttgggggattgatc
tcctttacaccggcgatgcctatcaccgccgatatcaatgcttactcacaattagccaaa
gcgattacagaacggcgcaccgtcagggcgccttatcagccaacgcaggtgaatccaata
cagcaggcatgcctacagactttattcgacggctccccggtcacccttcatttctaccag
ggtgagccggtgcgccatgccgtcgcccaccttaccactcgatatgcgtctcttgatttc
tctcatcatcaggcttggcaagaaacctatcagttcattcggtttaatgaacgtcagtac
accgaggatggtttctatctgcataacctgtttggcccggtctccaacctgttcaagtgc
gttttccggatcgcctttcacccgaaactgaccccgctggccacgcgtttgcaattgccc
gccatgatggcgaaagggttggcaaaacaggtgggcgaagggccgcaatacctggcaatg
agcctgcaggatgaaagtgacgaacacctgtttatcgccggcatgacgctgggtcagctg
tggctgactttacactcatggggatggggcctgcatccgatcagcgtgctggtgcaacac
gccagtgcacggcatgccctgtccgatacgctggcgctggtcaacccagccgtttttttc
gcacgctttggtcatttgcaacaatctggcgcagccactcccaggcgcagttggcaaagt
attttaaccgtatcacatcaacattcggccgctgaaaccaaggccgatgtcagcaaattt
taa

DBGET integrated database retrieval system