Serratia sp. AS13: SerAS13_4893 Help Entry SerAS13_4893      CDS       T02012                                  Name (GenBank) Cell division protein zapB   KO K09892   cell division protein ZapB Organism sra  Serratia sp. AS13 Brite KEGG Orthology (KO) [BR:sra00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sra03036]     SerAS13_4893 Chromosome and associated proteins [BR:sra03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SerAS13_4893 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Seryl_tRNA_N Leu_zip PspA_IM30 DUF3450 UPF0242 Nuf2_DHR10-like Filament ERM_helical DUF7801 YabA FlaC_arch ADIP USHBP1_PDZ-bd Herpes_UL6 COG6_N DUF7491 V_ATPase_I DUF4757 HALZ DUF2968 Cnn_1N APG6_N bZIP_2 DivIC dCache_2 DUF6262 Motif Other DBs NCBI-ProteinID:  AEG30644 UniProt:  A0A7U3Z6P3 LinkDB All DBs Position complement(5298139..5298378) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKDKNNTLSHEVQAASGNHESLVRENQQLKE EQHVWQDRLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtatttgagaaattggaagcaaaagttcagcaggcgatcgataccatc accctgctgcagatggaaattgaagaactgaaagacaaaaacaatactctgtctcacgaa gttcaggctgcctcaggcaaccacgaatctctggtgcgtgaaaatcagcaactgaaagaa gagcagcacgtatggcaagatcgcctgcgcgcgctgctgggcaaaatggaagaagtctga

DBGET integrated database retrieval system