Sphingomonas radiodurans: LLW23_00350 Help Entry LLW23_00350       CDS       T08717                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srad  Sphingomonas radiodurans Pathway srad01100   Metabolic pathways srad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LLW23_00350    00074 Mycolic acid biosynthesis     LLW23_00350   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LLW23_00350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WBH16620 LinkDB All DBs Position complement(73745..73981) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVRDAITYIDEHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgctgaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gacaaggtgaccgaggatgccagcttcatcgacgatctgggtgcggacagcctcgacatc gtcgagctggtgatggcattcgaagaggaattcggcgtcgagatcccagacgatgccgcc gaaaagatcacgaccgtgcgcgacgcgatcacctatatcgacgagcacaaggcctga

DBGET integrated database retrieval system