Sphingomonas radiodurans: LLW23_01280 Help Entry LLW23_01280       CDS       T08717                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srad  Sphingomonas radiodurans Pathway srad01100   Metabolic pathways srad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srad00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LLW23_01280    00074 Mycolic acid biosynthesis     LLW23_01280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LLW23_01280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5666 DUF2827 Motif Other DBs NCBI-ProteinID:  WBH16786 LinkDB All DBs Position 281651..281893 Genome browser AA seq 80 aa AA seqDB search MSDRNSIIDTIQAQIEPFNKKSVTITEATTFQGDLEWDSLTVMDFVAAIEDEFDIIITMN MQAEIETVGQLADAVAKLKN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccgaaacagcatcatcgacacgatccaggcccagatcgaaccgttcaacaaa aagagcgtgacgatcaccgaagcgacgacgttccagggcgacctggaatgggattcgctg acggtgatggatttcgtcgcggcgatcgaggatgaattcgacatcatcatcacgatgaac atgcaggccgagatcgagaccgtcggccagctcgccgatgcggtggcgaagctgaagaac tga

DBGET integrated database retrieval system