Sphingomonas radiodurans: LLW23_03295
Help
Entry
LLW23_03295 CDS
T08717
Symbol
dnaG
Name
(GenBank) DNA primase
KO
K02316
DNA primase [EC:
2.7.7.101
]
Organism
srad
Sphingomonas radiodurans
Pathway
srad03030
DNA replication
Brite
KEGG Orthology (KO) [BR:
srad00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
LLW23_03295 (dnaG)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
srad03032
]
LLW23_03295 (dnaG)
Enzymes [BR:
srad01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.101 DNA primase DnaG
LLW23_03295 (dnaG)
DNA replication proteins [BR:
srad03032
]
Prokaryotic type
DNA Replication Initiation Factors
Initiation factors (bacterial)
LLW23_03295 (dnaG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DNAG_N
Zn_ribbon_DnaG
Toprim_2
Toprim_4
Toprim
Toprim_3
DnaB_bind
Motif
Other DBs
NCBI-ProteinID:
WBH17159
LinkDB
All DBs
Position
675394..677271
Genome browser
AA seq
625 aa
AA seq
DB search
MSLTPAFLDELRARTSLSALIGRTTKLTKAGREHKGCCPFHNEKTPSFYVNDDKGFYHCF
GCSAHGDAIRWMTDQRGLPFMDAVKELAQAAGMEVPALDKKSAERAEKAQSLHDVMAAAA
EWFCTQLDGLEGSAARELLDRRGIKAETKRTFGFGFAPDARGKLRAALKQFGDAMLIEAG
LLINVEGKEPYDRFRGRLMIPIRDQRGRVIAFGGRIIGDGEPKYLNSPDTPLFDKGRTLY
NIDRALPAARKANRVFVVEGYMDAIALAQAGIGEVVAPLGTALTEHQLERLWRIADVPTL
CFDGDNAGQKAAIRAAHRAMPMLAAGKSLKFVTLPEGQDPDDLIRAKGAGAFEALVRDAT
QLVDRLWAHELAAEPMTTPEERAGFRGRFAELAKAIADPVVRSEYQSEFRRRYDEQFAAP
PRAPFQPRQPFVPRKPGQKWSPPPAPVTEDAKAFRAIGIDRVLAKAVLAGLIRHPVEIAR
HVEVLGSLRLADGALGRLFEAVVDVALEDQALDSGRLVTILAQSGFETVARDLLRADTMP
YSFTQATGDETRAREDLDEAIAILVARPEVDAALADATSAMQARFTDEAFQRQVALVREQ
QALDLRLANLVQSNEDARAFDAEDD
NT seq
1878 nt
NT seq
+upstream
nt +downstream
nt
atgtctctaacccccgccttcctcgacgaactccgcgcccgcacatcgctgtcggcgctg
atcggccgaaccaccaagctcaccaaggctggccgcgagcacaaaggctgctgcccgttc
cacaacgaaaagacgcccagcttctacgtcaacgacgacaagggcttctaccattgcttc
ggctgctcggcgcatggcgatgcgatccgctggatgaccgatcagcgcgggctgcccttc
atggatgcggtgaaggagcttgcgcaggccgccggcatggaagtccccgccctcgacaag
aagtcggccgagcgcgcggagaaagcgcagtcgctgcatgacgtcatggccgccgccgcc
gagtggttctgcacgcagctcgacgggctggagggcagcgccgcgcgtgagttgctcgac
cggcgcggcatcaaggcggagacaaagcgcaccttcggcttcggcttcgctcccgatgcg
cgcggcaagctgcgcgcggcgttgaagcagttcggcgatgcaatgctgatcgaggccggg
ctgctcatcaacgtcgagggcaaggagccctacgatcgcttccgcggccggctgatgatc
ccgatccgcgaccagcgcgggcgcgtgattgcgttcggcgggcggatcatcggcgacggc
gagccgaaatatctgaactcgcccgacaccccgctcttcgacaagggccgcacgctctac
aatatcgatcgcgcgctgcccgcggcgcgcaaggcgaaccgcgtgtttgtcgtcgaaggc
tatatggacgcaatcgcgctggcgcaggcggggatcggcgaagtcgtcgccccactcggc
accgcgctgaccgagcatcagctcgaacggctgtggcgcatcgccgatgtgccgacgctc
tgcttcgacggcgacaatgccggccagaaggccgcgatccgcgccgcgcaccgtgccatg
ccgatgctggcggcgggcaagagcctcaagttcgtcaccttgcccgaggggcaggatccc
gacgatctgatccgcgccaagggcgccggcgcgttcgaggcgctcgttcgcgacgcaaca
cagctagtcgatcgactatgggcgcacgaactcgctgccgagccgatgacgactcccgag
gagcgcgccggcttccgcggccgcttcgcggaattggccaaggcaatcgccgatccggtc
gtccgctccgaataccaatccgaattccgccgccgctacgacgagcagttcgccgccccg
ccgcgcgcgccgtttcaaccgcgccaacccttcgtgcctcgcaagccggggcagaaatgg
tcgcccccgcctgcccccgtcaccgaggatgccaaagcgtttcgcgcgatcgggatcgat
cgcgtgcttgccaaggcagtgctcgccggactgatccgccacccggtggaaatcgcacgg
catgtcgaggtattgggatcgcttcggctggcggatggcgcgctcggacgattgttcgag
gccgtggtggatgtcgcgcttgaagatcaggcgcttgatagcggccgcctggttaccata
ttggcgcaaagcggtttcgaaacggtcgcccgcgacctcttgagagccgatacgatgcct
tattccttcacccaagcgacgggggacgagacgcgcgccagggaagaccttgacgaagcg
atagcgatcctcgtggcgcggcccgaagtggatgcggcgctggccgatgcgacttccgcc
atgcaggcacgcttcactgatgaagcgtttcagcggcaggtggcattggtcagggaacaa
caggcgctggaccttcgacttgcaaatctcgtgcagtcgaacgaagacgcccgcgctttt
gatgccgaggacgattga
DBGET
integrated database retrieval system