Sphingomonas radiodurans: LLW23_07635
Help
Entry
LLW23_07635 CDS
T08717
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
srad
Sphingomonas radiodurans
Brite
KEGG Orthology (KO) [BR:
srad00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
srad03016
]
LLW23_07635 (truB)
Enzymes [BR:
srad01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
LLW23_07635 (truB)
Transfer RNA biogenesis [BR:
srad03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
LLW23_07635 (truB)
Prokaryotic type
LLW23_07635 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
TruB_C
Motif
Other DBs
NCBI-ProteinID:
WBH17954
LinkDB
All DBs
Position
complement(1583738..1584754)
Genome browser
AA seq
338 aa
AA seq
DB search
MNGWLIIDKPLGLGSTQGVSAVKRALREGGYAKAKVGHGGTLDPLATGVLPIALGEATKL
AGRMLDSDKVYDFTIRFGEQTDTLDREGTVIATSGVRPTLAAVEAVLADFTGAIEQMPPA
FSALKVDGQRAYDLARAGEEVVLATRAVTVYSLTILPELARGGGPLASGERWRGNATDDL
LAALPLHHQPAAGGPPPQAKLGEDLDEITLTAHVSKGTYIRSLARDIAAALGTVGHVTYL
RRTKAGPFGLAQAISLDKLSEVAKARNLEQVLLPLRAGLDDIPALPLTPDQAGALRQGRV
LDGIAADDGQYFACLHDVPVALIEVQAREGRVVRGFNL
NT seq
1017 nt
NT seq
+upstream
nt +downstream
nt
gtgaacggctggctgatcatcgacaagccgttgggcctgggctcgacgcaaggcgtgagc
gcggtgaagcgcgcgctgcgcgaaggcggctatgccaaggcgaaggtcggccacggcggc
acgctcgatccgctggcgaccggcgtgctgccgatcgcgctgggcgaagcgacgaagctc
gccgggcgaatgctcgacagcgacaaggtctacgatttcacgatccgcttcggcgaacag
accgacacgctcgaccgcgaaggcacggtgatcgcaacgagcggagtgcggccgacgctg
gcggcggtcgaggcggtgctggcggatttcaccggcgcgatcgaacagatgccgccggcg
ttttcggcgctgaaggtggacggtcagcgcgcgtacgatctggcgcgggcgggggaggaa
gtggttctcgcgacgcgagcggtgacggtgtattctttgaccatcctccctgagcttgct
cggggagggggaccgctcgcctcaggcgagcggtggaggggaaatgccacggacgatctg
ctcgcggctcttcccctccaccaccagcctgcggctggcggtccccctccccaagcaaag
cttggggaggatttggacgaaatcaccctcaccgcccacgtctcgaaaggcacctacatt
cgctccctcgcgcgcgacatcgcagcggcgctcggcaccgtcggccacgtcacctacctg
cgccgcaccaaggccggcccgttcggcctcgcccaggcgatatcgctggacaaattgagc
gaagtcgctaaggcgcgcaaccttgaacaggtacttctgccgctgagggcggggctggac
gacatcccggctctacccctcacacccgaccaggcaggggcgctccgccaggggcgtgtt
ctggacgggatcgctgccgacgatggacagtatttcgcctgcctgcacgacgtgccggtt
gcgctgatcgaggtccaggcccgcgagggccgtgtcgtccgcggtttcaacttatga
DBGET
integrated database retrieval system