Sphingomonas radiodurans: LLW23_14675
Help
Entry
LLW23_14675 CDS
T08717
Name
(GenBank) PEP-CTERM sorting domain-containing protein
Organism
srad
Sphingomonas radiodurans
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
PEP-CTERM
Motif
Other DBs
NCBI-ProteinID:
WBH16037
LinkDB
All DBs
Position
complement(3119246..3119515)
Genome browser
AA seq
89 aa
AA seq
DB search
MSSSTSTSSSSSGNVSTSTSTSSSSYGSSSKGWGSSHGSSHGWGSNGGHSSGNSSGNPSP
VPAPPMLILFGAAAAALIARRRLGKQVAA
NT seq
270 nt
NT seq
+upstream
nt +downstream
nt
gtgtcgtcgtccacctcgacctcctcatcgtcgagcggcaacgtctccacgtccacctcg
acttcaagctcgtcctacggctcgtcgtcgaagggctggggatcgagccatggttcgtcg
cacggctggggatcgaacggcgggcacagcagcggcaacagcagcggcaatccctcgccg
gtgccggccccgccgatgctgatcctgttcggcgctgccgccgcagcgctgatcgcgcgt
cgccggctcgggaagcaagtcgccgcctga
DBGET
integrated database retrieval system