Staphylococcus ratti: LN051_07110 Help Entry LN051_07110       CDS       T08246                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srai  Staphylococcus ratti Pathway srai00998   Biosynthesis of various antibiotics srai01100   Metabolic pathways srai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LN051_07110    00074 Mycolic acid biosynthesis     LN051_07110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LN051_07110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 PP-binding_2 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  UEX89349 LinkDB All DBs Position complement(1484578..1484811) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNYINTLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagatatcatcgttgaccgtttaggcgttgatgctgac aaggttactgaagatgcttcattcaaagatgatttaggcgcagattcacttgacattgct gaattagtaatggaattagaagatgaattcggtacagagattcctgatgaagaagctgaa aaaatcaacacagttggagatgctgtgaattacattaatacacttgaaaaataa

DBGET integrated database retrieval system