Candidate division SR1 bacterium RAAC1_SR1_1: P148_SR1C001G1062
Help
Entry
P148_SR1C001G1062 CDS
T02946
Name
(GenBank) hypothetical protein
KO
K02342
DNA polymerase III subunit epsilon [EC:
2.7.7.7
]
Organism
srb
Candidate division SR1 bacterium RAAC1_SR1_1
Pathway
srb03030
DNA replication
srb03430
Mismatch repair
srb03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
srb00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
P148_SR1C001G1062
03430 Mismatch repair
P148_SR1C001G1062
03440 Homologous recombination
P148_SR1C001G1062
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
srb03032
]
P148_SR1C001G1062
03400 DNA repair and recombination proteins [BR:
srb03400
]
P148_SR1C001G1062
Enzymes [BR:
srb01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
P148_SR1C001G1062
DNA replication proteins [BR:
srb03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
P148_SR1C001G1062
DNA repair and recombination proteins [BR:
srb03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
P148_SR1C001G1062
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RNase_T
DEDDh_C
RNase_H_2
DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID:
AHB41840
LinkDB
All DBs
Position
complement(1138296..1138832)
Genome browser
AA seq
178 aa
AA seq
DB search
MTFVIIDLETTGLSPYKHSITEIAAVRFDGNQVVDTFQSLVNPERHIPTFITKLTGINNE
MVENAPIIQDILPEFISFLGEDIFVAHNISFDLGFLNYARYTHLGCYFSNPTLCTRKLAR
HLIPEVPKRNLGFLCEHFGITNTRAHRALSDVHATTELLKNYLRIMNSEGRKVEEFLG
NT seq
537 nt
NT seq
+upstream
nt +downstream
nt
atgacattcgttattatcgatcttgaaacaacgggattaagtccctataagcatagtatt
accgaaattgctgcggttcgttttgatggaaatcaggttgttgacacgtttcaaagtttg
gtaaatccagaaagacatattcctaccttcattacaaaactcacaggaatcaacaatgaa
atggtagaaaatgcaccaattatccaagacatcttacctgaatttatttcttttttgggc
gaagacatttttgtcgctcacaatatttcctttgatttgggcttcttaaattatgctcgt
tatactcatcttggatgttatttttccaatcctacgctatgtacgagaaagcttgcgaga
catcttattcctgaagttcccaaaagaaatctaggttttttatgtgaacattttggtatc
actaatacccgcgcccatagagcactttctgatgttcatgctactactgaattactcaaa
aactaccttcgtattatgaacagtgaatgaagaaaagtagaagaatttttgggataa
DBGET
integrated database retrieval system