Streptomyces rapamycinicus: M271_33370 Help Entry M271_33370        CDS       T02907                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism src  Streptomyces rapamycinicus Pathway src00998   Biosynthesis of various antibiotics src01100   Metabolic pathways src01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:src00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M271_33370    00074 Mycolic acid biosynthesis     M271_33370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M271_33370 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGP58089 UniProt:  A0A0A0NMA2 LinkDB All DBs Position complement(8234617..8234865) Genome browser AA seq 82 aa AA seqDB search MAATQEEILEGLAEIVNEIAGIPTEDVLLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDAVDYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcctcgagggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtcctgctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtggtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccgtcgactacatcctcaagcac cagggctga

DBGET integrated database retrieval system