Streptomyces rapamycinicus: M271_43890 Help Entry M271_43890        CDS       T02907                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism src  Streptomyces rapamycinicus Pathway src00998   Biosynthesis of various antibiotics src01100   Metabolic pathways src01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:src00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M271_43890    00074 Mycolic acid biosynthesis     M271_43890   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M271_43890 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AGP60146 UniProt:  A0A0A0NRY7 LinkDB All DBs Position 10856905..10857156 Genome browser AA seq 83 aa AA seqDB search MSALVQERRDDIKEIVCDILEIDPEELTDSSLLKEDHDADSLRAIEILAALEKTFEISID QAEMSRMVNLDGIYAVVAEASGK NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgcacttgtgcaggagcgccgcgatgacatcaaggaaatcgtctgcgacatcctt gaaatcgatccggaggaattgacggacagcagccttctgaaggaggaccacgacgccgac tccctgcgggccatcgagatcctggccgccctggagaagacgttcgaaatctccatcgac caggcggagatgtcgcgcatggtgaatctcgacgggatttatgcggtggtcgccgaggcg agcggcaagtaa

DBGET integrated database retrieval system