Streptomyces rapamycinicus: M271_43940 Help Entry M271_43940        CDS       T02907                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism src  Streptomyces rapamycinicus Pathway src00998   Biosynthesis of various antibiotics src01100   Metabolic pathways src01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:src00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M271_43940    00074 Mycolic acid biosynthesis     M271_43940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M271_43940 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AGP60156 UniProt:  A0A0A0NRZ5 LinkDB All DBs Position 10865010..10865273 Genome browser AA seq 87 aa AA seqDB search MPDTQPTPLDLEDLRRTIAEVFCVDPGEVTDETRFVEDLGGDSLLALEVIVALEKKYTVR FAESDVRALTTLPRTYDVLADKLGAHG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcccgacactcaaccgacccccctcgacctggaagacctgcggcgcaccatcgccgag gtgttctgcgtggacccgggcgaggtgaccgacgaaacccgcttcgtggaggatctgggc ggcgattcgctgctggcgctcgaggtgatcgtcgccctggagaagaagtacaccgtgcgg ttcgcggagtcggatgtgcgcgcgctgaccacgctgccacggacctacgacgtgctcgcg gacaagctcggagcccacggatga

DBGET integrated database retrieval system