Salpingoeca rosetta: PTSG_05105 Help Entry PTSG_05105        CDS       T04136                                  Name (RefSeq) uncharacterized protein   KO K13113   ubiquitin-like protein 5 Organism sre  Salpingoeca rosetta Brite KEGG Orthology (KO) [BR:sre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:sre03041]     PTSG_05105   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sre04052]     PTSG_05105 Spliceosome [BR:sre03041]  Complex B   Other components    Complex B specific factors     PTSG_05105 Cytokines and neuropeptides [BR:sre04052]  Neuropeptides   Unclassified    PTSG_05105 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Tautomerase Crinkler Rad60-SLD OTU1_UBXL Motif Other DBs NCBI-GeneID:  16074269 NCBI-ProteinID:  XP_004993690 UniProt:  F2UAJ2 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEITCNDRLGKKVRVKCNEDDTVGDLKKLVAALTGTRADKIILKKWYTIFKDHITLADY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgagattacttgcaatgaccgccttggcaagaaggtccgcgtcaagtgcaatgag gatgacaccgtcggcgacctgaagaagttggtggctgcattgacgggtacacgtgcggat aagattatcttgaagaagtggtacaccatcttcaaggatcacattacgctggcagactac gaaatccacgacggcatgaacctcgagctctattaccagtaa

DBGET integrated database retrieval system