Salpingoeca rosetta: PTSG_05236 Help Entry PTSG_05236        CDS       T04136                                  Name (RefSeq) uncharacterized protein   KO K11368   enhancer of yellow 2 transcription factor Organism sre  Salpingoeca rosetta Brite KEGG Orthology (KO) [BR:sre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sre03021]     PTSG_05236    03019 Messenger RNA biogenesis [BR:sre03019]     PTSG_05236    03036 Chromosome and associated proteins [BR:sre03036]     PTSG_05236 Transcription machinery [BR:sre03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      PTSG_05236 Messenger RNA biogenesis [BR:sre03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      PTSG_05236 Chromosome and associated proteins [BR:sre03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      PTSG_05236 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EnY2 Fer4_22 TarS_linker Motif Other DBs NCBI-GeneID:  16074393 NCBI-ProteinID:  XP_004993814 UniProt:  F2UAW6 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSHTHTHTQSHIPCNVVCFACACSDPAQSEEQLRASINQQLIESGQKERLKAMLRDELKK SNWRDRVRDLASEMVPEEVKMKLMANIQRSLRQTVDEDNASSN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgagtcacacacacacacacacacaatctcacattccttgcaacgtggtatgttttgct tgtgcttgcagtgatccggcacaatccgaggaacagcttcgagcgtcaatcaaccagcag ttgattgagagcggacagaaagagaggctcaaggccatgctcagagatgagttgaagaag agcaattggcgtgatcgcgtgcgcgacttggcaagcgagatggtaccggaggaagtgaag atgaagctcatggccaatattcaacgcagcctgcggcaaactgtcgacgaggataatgcc tcatctaactga

DBGET integrated database retrieval system