Salpingoeca rosetta: PTSG_05354 Help Entry PTSG_05354        CDS       T04136                                  Name (RefSeq) LSM domain-containing protein   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism sre  Salpingoeca rosetta Pathway sre03018   RNA degradation sre03040   Spliceosome Brite KEGG Orthology (KO) [BR:sre00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     PTSG_05354   09123 Folding, sorting and degradation    03018 RNA degradation     PTSG_05354  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sre03019]     PTSG_05354    03041 Spliceosome [BR:sre03041]     PTSG_05354 Messenger RNA biogenesis [BR:sre03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      PTSG_05354   mRNA degradation factors    5'-3' decay     Lsm complex      PTSG_05354 Spliceosome [BR:sre03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     PTSG_05354  Complex C   U2 snRNP components     PTSG_05354 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  16074503 NCBI-ProteinID:  XP_004993925 UniProt:  F2UA69 LinkDB All DBs Position Unknown AA seq 112 aa AA seqDB search MILLSILFHTNKSSTIKMLFTSFFKTLVGKTVVVELKNDLSIQGTLTSVDQFLNIKLDDI TVGNVDKYAHMVSVKNCFIRGSVIRYIQLPPEHVDTQLLQDATRREAGEKSA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgattttgctgagtattctcttccacaccaacaaatcctcaacaatcaagatgctgttc acctccttcttcaagacgctcgtcgggaagacggtcgttgtggagctcaagaatgacctg agcatacaaggaaccttgacatccgtcgatcagttcctcaacattaagctggatgacatc accgtcggcaacgtggacaagtacgcacacatggtctctgtgaagaactgcttcatccgc ggttctgtgatccgctacatccagctcccgccagaacacgtcgacacacagctgctgcag gacgccacccggcgcgaggctggcgagaaaagcgcgtag

DBGET integrated database retrieval system