Salpingoeca rosetta: PTSG_09252 Help Entry PTSG_09252        CDS       T04136                                  Name (RefSeq) uncharacterized protein   KO K08336   ubiquitin-like protein ATG12 Organism sre  Salpingoeca rosetta Pathway sre04136   Autophagy - other Brite KEGG Orthology (KO) [BR:sre00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     PTSG_09252  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sre04131]     PTSG_09252    04121 Ubiquitin system [BR:sre04121]     PTSG_09252    03029 Mitochondrial biogenesis [BR:sre03029]     PTSG_09252 Membrane trafficking [BR:sre04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     PTSG_09252 Ubiquitin system [BR:sre04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PTSG_09252 Mitochondrial biogenesis [BR:sre03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     PTSG_09252 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 Trimer_CC NLRC4_HD Rpp20 E1_FCCH Motif Other DBs NCBI-GeneID:  16070056 NCBI-ProteinID:  XP_004989507 UniProt:  F2UN59 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MADRQTPVISAPHTEVLVTFTAAAGAPQLKESKRKIKVKSHKAFQAVVQHLQKLLDKKTL FVYINQISPSLDATIGQLAAFYGHVTAKGTYRLPLQYSVTPAWG NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcagatcgccaaacgcccgtcatctccgcaccgcacacggaagtgctggtgacattc acggcagcagcaggagcgccgcagctgaaggagtccaagcgcaagatcaaagtcaagtca cacaaggccttccaggctgttgtacaacacttgcaaaagctccttgacaagaagaccttg tttgtgtacatcaaccaaatatcaccgtcgctcgacgccaccatcggccagctcgcagcg ttctatgggcacgtgacggcgaaagggacgtaccgccttcctctgcagtactctgtaacg cctgcgtggggttga

DBGET integrated database retrieval system