Salpingoeca rosetta: PTSG_11312 Help Entry PTSG_11312        CDS       T04136                                  Name (RefSeq) DNA-directed RNA polymerase I   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism sre  Salpingoeca rosetta Pathway sre03020   RNA polymerase sre03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sre00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PTSG_11312   09124 Replication and repair    03420 Nucleotide excision repair     PTSG_11312  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:sre03021]     PTSG_11312    03400 DNA repair and recombination proteins [BR:sre03400]     PTSG_11312 Transcription machinery [BR:sre03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PTSG_11312   RNA polymerase III system    RNA polymerase III      PTSG_11312   RNA polymerase I system    RNA polymerase I      PTSG_11312 DNA repair and recombination proteins [BR:sre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PTSG_11312 SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  16068183 NCBI-ProteinID:  XP_004987671 UniProt:  F2UT16 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MIIPVRCFSCGKVIGNKYKRFLGFVDAEYGESKALDEVGLKRYCCRRMLLTHVDLIEKLL EYSALEQRD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgatcatccctgtgcgctgcttctcctgcggcaaggtgattggcaacaagtacaagcgc tttctcggctttgtggatgcagagtacggcgagagcaaagcgttggatgaggttggcctg aagcggtattgctgccgtcgtatgctgctgacacacgtggatctcattgagaagctcctc gagtactctgcccttgagcagcgcgactga

DBGET integrated database retrieval system