Stenotrophomonas rhizophila: BAY15_1039 Help Entry BAY15_1039        CDS       T04500                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srh  Stenotrophomonas rhizophila Pathway srh01100   Metabolic pathways srh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAY15_1039    00074 Mycolic acid biosynthesis     BAY15_1039   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAY15_1039 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  AOA71473 UniProt:  A0AAP5AJ77 LinkDB All DBs Position 1197137..1197376 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVVTTASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKISTVQAAIDYVKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacagcttggcgtcaaggaa gaagaagttgtcaccaccgcatcgttcgtcgatgacctgggtgccgactccctggacacc gttgaactggtgatggcgctggaagaagaattcgagtgcgagatcccggacgaagaagcc gagaagatcagcaccgtccaggctgcgatcgactacgtcaaggctcacgtcaaggcgtga

DBGET integrated database retrieval system