Stenotrophomonas rhizophila: BAY15_2439 Help Entry BAY15_2439        CDS       T04500                                  Name (GenBank) hypothetical protein   KO K02196   heme exporter protein D Organism srh  Stenotrophomonas rhizophila Pathway srh02010   ABC transporters Brite KEGG Orthology (KO) [BR:srh00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     BAY15_2439  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:srh02000]     BAY15_2439 Transporters [BR:srh02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     BAY15_2439 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD FxsA DUF7677 Motif Other DBs NCBI-ProteinID:  AOA72873 LinkDB All DBs Position 2790729..2790914 Genome browser AA seq 61 aa AA seqDB search MTHVGFIAAAYAVFVLVLAADALGSWLRLRSARRQALQRQLRQAARDQRTPGTPLATELS R NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgacgcatgtcgggttcattgccgccgcgtacgcggtgttcgtgctggtgctggcggcc gacgcgctgggttcctggctgcgcctgcgcagcgcgcgtcgccaggcccttcagcgccag ctgcgccaggccgcgcgcgaccagcgcacgccgggcacgccgctggccacggagctgagc cgatga

DBGET integrated database retrieval system