Sphingomonas rhizophila: H9L12_06675 Help Entry H9L12_06675       CDS       T07014                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srhi  Sphingomonas rhizophila Pathway srhi01100   Metabolic pathways srhi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srhi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9L12_06675    00074 Mycolic acid biosynthesis     H9L12_06675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9L12_06675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  QNN64089 UniProt:  A0A7G9S8B4 LinkDB All DBs Position complement(1323176..1323412) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVDAEKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAISYIDSNKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgccgatcgggtgaagaagatcgttgtcgaacatcttggcgtcgacgcc gagaaggtgacggaggaagcgagcttcatcgacgatctcggtgccgacagcctcgacatc gtcgagctggtgatggcgttcgaggaagaattcggggtcgaaatcccggacgacgccgcc gagaagatcacgaccgtcaaggacgcgatcagctacatcgacagcaacaagggctga

DBGET integrated database retrieval system