Shewanella rhizosphaerae: K0I63_18150 Help Entry K0I63_18150       CDS       T09262                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srhs  Shewanella rhizosphaerae Pathway srhs01100   Metabolic pathways srhs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srhs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0I63_18150    00074 Mycolic acid biosynthesis     K0I63_18150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0I63_18150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QYK12621 LinkDB All DBs Position 4193732..4193986 Genome browser AA seq 84 aa AA seqDB search MSLQNEIKQLIIDCLDLEDVSIDDIDTDAPLFGDGLGLDSIDALELGLAIKKQFDVKIEA NSEATKAHFYSVASLASFIESQRG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacaaaacgaaattaaacaactcatcatagattgcctggatctcgaagatgtc agcatcgacgacatcgacacagatgcgccgctctttggcgacggtctgggactggactct atcgatgcacttgagctgggactggccatcaagaagcagttcgatgtcaaaatcgaagcc aactcggaagccaccaaggcccatttctacagtgttgccagcctggcaagctttatcgaa tctcaacgcggttag

DBGET integrated database retrieval system