Serratia rhizosphaerae: FO014_05630 Help Entry FO014_05630       CDS       T07504                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srhz  Serratia rhizosphaerae Pathway srhz01100   Metabolic pathways srhz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srhz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FO014_05630    00074 Mycolic acid biosynthesis     FO014_05630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FO014_05630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QHA86494 LinkDB All DBs Position complement(1175053..1175313) Genome browser AA seq 86 aa AA seqDB search MHLLSTEIKQLIIDSLNLEGMTPDEIDTQAPLFGEGLGLDSIDALELGLALKNRYGVVLS AESDDMRQHFYSVETLAAFVSAQRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcatttattgagcaccgaaatcaagcaattgattattgattcgctcaatcttgaaggc atgacgccggatgagattgacacacaggcgcctttgttcggcgaaggattaggactggat tccattgatgcgttggaattggggctggcgttgaaaaaccgctatggcgttgtgctgtcg gccgaaagcgacgatatgcgtcagcatttttattctgtggaaacgttggccgcgtttgtt tccgcacagcgtagcaaataa

DBGET integrated database retrieval system