Serratia rhizosphaerae: FO014_19890
Help
Entry
FO014_19890 CDS
T07504
Name
(GenBank) PLP-dependent aminotransferase family protein
Organism
srhz
Serratia rhizosphaerae
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
GntR
Asp_aminotransf
Motif
Other DBs
NCBI-ProteinID:
QHA89062
UniProt:
A0ABX6GS55
LinkDB
All DBs
Position
4273945..4275363
Genome browser
AA seq
472 aa
AA seq
DB search
MTRYEQLAQQIREQIQNRVWRAGDKLPSLRESGRRAGLSLMTVVQSYQLLESQGWIVARP
QSGYYVAARPQPLPQATHGEKLLLSEQVDINAFIFDVLQACKDPQIVPFGSAFPDATLFT
QPKLARALSSVARKFTPHSSLVNLPPGNDALRRNIAQRYALSGMQVAPDEIVITAGAMES
LSLSLQAVTQPGDYVAIESPAFYGALQALERLRLKAVAIPTHPQHGIELEPLEQALTQYP
IKACWLMTHFQNPQGATMPEANKQRLVALLRQRQIALIEDDVYGELYFGAERPLPAKALD
TDGLVLHCSSFSKCLAPGFRVGWVAAGRQAAQIQRLQLMSTVSASVPMQMAIADYLLHGG
YDTHLRRLRRLLAQRQSAMRQAIAHYFPPTVNVSQPDGGYFLWLELAPGLSAMALYQRAL
AQGISIAPGRMFTTGDHFNHCFRLNASFEWNDRLEAAIRTLGELIRQQSPES
NT seq
1419 nt
NT seq
+upstream
nt +downstream
nt
atgacacgatatgaacaattggcgcagcaaatccgcgaacagatccaaaaccgggtgtgg
cgcgccggcgataaattgccgtcgctgcgggaaagcggcaggcgtgcgggactcagcctg
atgacggtggtgcaatcctaccaactgctggaaagccagggctggatcgtggcgcgcccg
cagtccggctattacgtggccgcccggccgcagccgctgccgcaggcgacgcatggcgaa
aagctcctgctgagcgagcaggtggatatcaacgcctttattttcgacgtgttgcaggcc
tgcaaggatccgcagattgtgccgtttggttcggcgtttccggatgcgacgctgtttacc
cagccgaaactggcgcgggcgctcagcagcgtggcgcgcaagttcacgccgcacagttcg
ctggttaacctgccgccgggcaatgatgcgctgcggcgcaatattgcgcagcgctatgcg
ttaagcggcatgcaggtggcgccggatgaaattgtcattaccgccggcgcgatggagtcg
ctcagccttagcctgcaggcggtcacgcagcccggcgactatgtggccattgagtcgccg
gctttttacggcgcactgcaggcgctggagcggctgcgcctgaaagcggtggcgataccc
acccatccgcagcacggtattgaactggagccgttggaacaggcgctgacgcagtatccg
atcaaggcctgctggctgatgacccatttccagaacccgcagggcgccacgatgccggag
gccaataaacagcggctggtggcgctgctgcggcagcggcaaatcgcgctgattgaggat
gatgtctacggcgagctctatttcggcgctgaacggccgctgccggccaaggcgctggac
acggacggtctagtgctgcactgctcgtccttctccaagtgtctggcgccgggttttcgc
gtcggttgggtcgccgccggccggcaggccgcacagatccagcgtctgcagctgatgagc
accgtatccgccagcgtaccgatgcagatggcgatcgccgattacctgctacacggcggt
tatgacacgcatttgcggcgtttacgtcgcctgctggcgcagcggcaaagcgcgatgcgt
caggcgattgcgcattattttcccccgacggtcaacgtcagccagccggacggcggctat
tttttatggctggagctggcgccgggcctgtcggcgatggcgctgtaccagcgggcgctg
gcgcagggcatcagtattgcgcccggtcgtatgtttacgaccggcgaccatttcaaccac
tgtttccgcctgaacgcctcgtttgagtggaatgaccggctggaagcggcgatccgcacc
ctcggcgagctgatccgccagcagtcgccggaatcctag
DBGET
integrated database retrieval system