KEGG   Streptomyces rimosus: CP984_02455
Entry
CP984_02455       CDS       T07052                                 
Name
(GenBank) PPOX class F420-dependent oxidoreductase
  KO
K21301  5a,11a-dehydrotetracycline reductase [EC:1.3.98.4]
Organism
srim  Streptomyces rimosus
Pathway
srim00253  Tetracycline biosynthesis
srim01057  Biosynthesis of type II polyketide products
srim01100  Metabolic pathways
srim01110  Biosynthesis of secondary metabolites
Module
srim_M00780  Tetracycline/oxytetracycline biosynthesis, pretetramide => tetracycline/oxytetracycline
Brite
KEGG Orthology (KO) [BR:srim00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    CP984_02455
   00253 Tetracycline biosynthesis
    CP984_02455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:srim01008]
    CP984_02455
Enzymes [BR:srim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.4  5a,11a-dehydrotetracycline reductase
     CP984_02455
Polyketide biosynthesis proteins [BR:srim01008]
 Polyketide tailoring proteins
  Others
   CP984_02455
SSDB
Motif
Pfam: Putative_PNPOx Pyridox_ox_2
Other DBs
NCBI-ProteinID: QEV74086
LinkDB
Position
complement(651421..651849)
AA seq 142 aa
MPFTQKEITYLRAQGYGRLATVGAHGEPHNVPVSFEIDEERGTIEITGRDMGRSRKFRNV
AKNDRVAFVVDDVPCRDPEVVRAVVIHGTAQALPTGGRERRPHCADEMIRIHPRRIVTWG
IEGDLSTGVHARDITAEDGGRR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgccgttcacccagaaggaaatcacctacctgcgcgcgcagggctacggccgtctggcg
acggtcggcgcccatggagaaccccacaacgtgcccgtctcgttcgagatcgacgaggag
cgcggcaccatcgagatcaccggccgggacatgggccgcagccgcaagttccggaacgtg
gcgaagaacgaccgggtcgccttcgtcgtggacgacgtgccgtgccgcgaccccgaggtg
gtccgcgccgtcgtcatccacggcacggcccaggcgctgcccaccggcggcagggagcgc
cggccgcactgcgccgacgagatgatccgcatccacccccggcgcatcgtcacctggggc
atcgaaggggacctgtccaccggggtccacgcacgcgacatcacggccgaggacggagga
cggcgatga

DBGET integrated database retrieval system