KEGG   Streptomyces rimosus: CP984_11205
Entry
CP984_11205       CDS       T07052                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
srim  Streptomyces rimosus
Pathway
srim00770  Pantothenate and CoA biosynthesis
srim01100  Metabolic pathways
srim01240  Biosynthesis of cofactors
Module
srim_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:srim00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CP984_11205
Enzymes [BR:srim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     CP984_11205
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig HcgB
Other DBs
NCBI-ProteinID: QEV75514
LinkDB
Position
complement(2769084..2769593)
AA seq 169 aa
MTGPESEETHVRRAVCPGSFDPITNGHLDIIARASRLYDVVHVTVMINKAKQGLFSIDER
IDLIRRATAEYGNVEVESFHGLLVDFCKQRDIPAIVKGLRAVSDFDYELQMAQMNNGLSG
VETLFIPTSPTYSFLSSSLVKEVAAWGGDVSHLVPPFVLEELTARLGAK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaccggaccggagagcgaggaaactcacgtgcgccgcgcagtctgtccggggtcgttc
gaccccatcaccaacgggcacctggacatcattgcccgggcctccaggctctacgacgtc
gtccacgtcaccgtgatgatcaacaaggccaagcagggcctgttctcgatcgacgagcgg
atcgacctgatccgccgcgccaccgccgagtacggcaacgtcgaggtcgagtccttccac
ggcctgctcgtcgacttctgcaagcagcgtgacattccggccatcgtcaaggggctgcgc
gcggtcagcgacttcgactacgagctccagatggcgcagatgaacaacggcctctccggc
gtcgagaccctcttcatccccaccagccccacctacagcttcctctcctccagcctggtc
aaggaggtcgcggcctggggcggcgacgtctcccacctggtgccgcccttcgtcctggaa
gagctgaccgcgcggctgggcgccaagtga

DBGET integrated database retrieval system