Streptomyces rimosus: CP984_17945 Help Entry CP984_17945       CDS       T07052                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srim  Streptomyces rimosus Pathway srim00998   Biosynthesis of various antibiotics srim01100   Metabolic pathways srim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP984_17945    00074 Mycolic acid biosynthesis     CP984_17945   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP984_17945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEV76647 LinkDB All DBs Position 4278984..4279229 Genome browser AA seq 81 aa AA seqDB search MTREEIIAGLAEILNEVADVEPAEVSEEKAFIEDLDVDSLAMVEVIVAVEERFGVSLPEE ELKELRLVSDIVLRVEKQLTA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgcgtgaagagatcatcgccggactcgccgagatcctcaacgaggtcgccgacgtc gaacccgccgaggtgagcgaggagaaggccttcatcgaggacctggacgtcgactcgctg gccatggtcgaggtcatcgtcgccgtcgaggagcgcttcggcgtcagcctccccgaggag gagctgaaggagctgcgcctggtctccgacatcgtgctccgcgtcgagaagcagctgacg gcctga

DBGET integrated database retrieval system