Streptomyces rimosus: CP984_28100 Help Entry CP984_28100       CDS       T07052                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srim  Streptomyces rimosus Pathway srim00998   Biosynthesis of various antibiotics srim01100   Metabolic pathways srim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srim00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP984_28100    00074 Mycolic acid biosynthesis     CP984_28100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP984_28100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEV78323 LinkDB All DBs Position complement(6480075..6480323) Genome browser AA seq 82 aa AA seqDB search MAATKEEIVAGLAEIVNEIAGIPAEDVQLEKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccaccaaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccgccgaggacgtccagctggagaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgattacatcctcaagcac cagggctga

DBGET integrated database retrieval system