Streptomyces rochei: SRO_1563 Help Entry SRO_1563          CDS       T06265                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srj  Streptomyces rochei Pathway srj00261   Monobactam biosynthesis srj01100   Metabolic pathways srj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SRO_1563  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srj01008]     SRO_1563 Polyketide biosynthesis proteins [BR:srj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SRO_1563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBC92739 LinkDB All DBs Position complement(1764091..1764303) Genome browser AA seq 70 aa AA seqDB search MATNPFEDPEGRYVVLANDEGQHSLWPVGIQQPAGWTLVRDEGTKQECAEYIEANWTDLR PKSAVAAMGG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtggcaaccaacccttttgaggatccggaaggccgctacgtcgtactcgccaacgacgag ggccagcactccctctggccggtcggcatccagcagcccgcgggctggacgctggtgcgg gacgagggcacgaagcaggaatgcgccgagtacatcgaggccaactggacagacctgcgc cccaaatcggccgtcgcggccatgggcggctga

DBGET integrated database retrieval system