Streptomyces rochei: SRO_5054 Help Entry SRO_5054          CDS       T06265                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srj  Streptomyces rochei Pathway srj00998   Biosynthesis of various antibiotics srj01100   Metabolic pathways srj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SRO_5054    00074 Mycolic acid biosynthesis     SRO_5054   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SRO_5054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBC96230 LinkDB All DBs Position complement(5569744..5569992) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPVEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacccaggaagagatcgtcgaaggtctcgccgaaatcgtcaacgagatcgcc ggcatcccggttgaggacgtccaggtggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system