KEGG   Streptomyces rectiverticillatus: FGW37_26790
Entry
FGW37_26790       CDS       T06927                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
srk  Streptomyces rectiverticillatus
Pathway
srk00333  Prodigiosin biosynthesis
srk01100  Metabolic pathways
srk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FGW37_26790
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_3
Other DBs
NCBI-ProteinID: QLE74714
LinkDB
Position
complement(6093434..6094318)
AA seq 294 aa
MSPAEPLVAALPRDALWFPRFGAPPPAAGAAGTVLICFPYAGGTASVYRDWREHLGVEVA
ALQLPGRGLRMREEPYTSAQPLVADVADELVRQGFTRDYAFFGHSMGALLAYETACALRE
RGEPGPRHLFVSGSRAPHLYGDRTEHLLPDAELHRFATGIGALGDGDRALVNDAYLARRL
PVLRADLQVCNGYRWRPRRPLDCPMTAFSASDDPVAGAAEVEAWRAYTTSSFLRHHVPGD
HFFLTADGPSRERLLRELRGELARLPRATAPTAPAATDGAATPPSEQREPSWTY
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtcgcccgctgagccgctcgtcgccgccctcccccgggacgccctgtggttcccgcgc
ttcggggcgccgccgcccgccgccggcgccgcggggaccgtgctgatctgcttcccgtac
gcgggcggcacggcctccgtctaccgcgactggcgcgagcacctcggcgtggaggtcgcg
gccctgcagctgccggggcgcggcctgcggatgcgcgaggagccgtacacgtccgcgcag
ccgctcgtggccgacgtcgccgacgagctcgtacgccaagggttcacccgcgactacgcg
ttcttcgggcacagcatgggcgcgctgctggcctacgagaccgcctgcgcgctgcgggag
cgcggcgagcccgggccgcggcacctgttcgtctccggcagcagggcgccgcacttgtac
ggggaccgcaccgagcacctgctgcccgacgccgagctgcaccggttcgcgaccggcatc
ggcgcgctcggcgacggcgaccgggccctggtcaacgacgcctacctcgcgcggaggctg
ccggtcctccgggcggacctgcaggtctgcaacggctaccgctggcggccgcgccgtccc
ctggactgcccgatgacggcgttctccgcgagcgacgaccccgtcgccggggccgcggag
gtggaggcgtggcgcgcgtacacgacgagctcgttcctgcgccaccacgtgcccggcgac
cacttcttcctcaccgccgacggcccgtcgcgggagcggctgctgcgggagctgcgcggt
gagctcgcccgcctgccccgcgccacggcccccacggcccccgcagccaccgacggggcc
gccacgcccccctccgagcaaagggaaccctcatggacgtactga

DBGET integrated database retrieval system