Serratia plymuthica 4Rx13: SOD_c07460 Help Entry SOD_c07460        CDS       T02710                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism srl  Serratia plymuthica 4Rx13 Pathway srl00998   Biosynthesis of various antibiotics srl01100   Metabolic pathways srl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SOD_c07460    00074 Mycolic acid biosynthesis     SOD_c07460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SOD_c07460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGO53744 LinkDB All DBs Position 825019..825279 Genome browser AA seq 86 aa AA seqDB search MNLLSTEIKQLIIDTLNLEGMTPEEIDAEAPLFGDGLGLDSIDALELGLALKNRYGVVLS AESEDMRQHFYSVETLVKFVSALRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatttattgagcaccgaaatcaagcaattgatcattgatacgctcaatcttgaaggt atgacgccggaggagattgacgccgaagcaccgctgtttggtgatggactgggcctggac tcgattgatgcgttggaattgggcctggcattaaagaaccgttatggcgtggtgctgtca gctgaaagcgaagacatgcgccaacatttttattccgtggaaacgctggtgaagtttgtt tctgcactgcgtagcaaataa

DBGET integrated database retrieval system